PRR19 Antikörper (N-Term)

Produktnummer ABIN631767

Produktdetails anti-PRR19 Antikörper

Target: PRR19 (Proline Rich 19 (PRR19))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRR19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MGC70924 antibody was raised against the N terminal Of Mgc70924

Aufreinigung: Affinity purified

Immunogen: MGC70924 antibody was raised using the N terminal Of Mgc70924 corresponding to a region with amino acids MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC70924 Blocking Peptide, catalog no. 33R-5880, is also available for use as a blocking control in assays to test for specificity of this MGC70924 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC70924 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRR19

Target: PRR19 (Proline Rich 19 (PRR19))

Andere Bezeichnung: MGC70924 (PRR19 Produkte)

Synonyme: EG623131 antikoerper, MGC188639 antikoerper, proline rich 19 antikoerper, PRR19 antikoerper, Prr19 antikoerper

Hintergrund: The function of MGC70924 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 39 kDa (MW of target protein)