PRPSAP2 Antikörper (N-Term)

Produktnummer ABIN631768

Produktdetails anti-PRPSAP2 Antikörper

Target: PRPSAP2 (phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 (PRPSAP2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRPSAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRPSAP2 antibody was raised against the N terminal of PRPSAP2

Aufreinigung: Affinity purified

Immunogen: PRPSAP2 antibody was raised using the N terminal of PRPSAP2 corresponding to a region with amino acids MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRPSAP2 Blocking Peptide, catalog no. 33R-5987, is also available for use as a blocking control in assays to test for specificity of this PRPSAP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPSAP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRPSAP2

Target: PRPSAP2 (phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 (PRPSAP2))

Andere Bezeichnung: PRPSAP2 (PRPSAP2 Produkte)

Synonyme: PAP41 antikoerper, A230054F23Rik antikoerper, Pap41 antikoerper, phosphoribosyl pyrophosphate synthetase associated protein 2 antikoerper, phosphoribosyl pyrophosphate synthetase-associated protein 2 antikoerper, PRPSAP2 antikoerper, Prpsap2 antikoerper

Hintergrund: The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD.

Molekulargewicht: 41 kDa (MW of target protein)