Primary Retinal Dysplasia (PRD) (Middle Region) Antikörper

Produktnummer ABIN631772

Produktdetails

Target: Primary Retinal Dysplasia (PRD)

Bindungsspezifität: Middle Region

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRD antibody was raised against the middle region of PRD

Aufreinigung: Affinity purified

Immunogen: PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRD Blocking Peptide, catalog no. 33R-6573, is also available for use as a blocking control in assays to test for specificity of this PRD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Primary Retinal Dysplasia (PRD)

Andere Bezeichnung: PRD (PRD Produkte)

Synonyme: CG6716 antikoerper, Dmel\\CG6716 antikoerper, PRD antikoerper, Prd antikoerper, pr antikoerper, paired antikoerper, primary retinal dysplasia antikoerper, prd antikoerper, PRD antikoerper

Hintergrund: Prd is a pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments.

Molekulargewicht: 65 kDa (MW of target protein)