KLHL32 Antikörper

Produktnummer ABIN631778

Produktdetails anti-KLHL32 Antikörper

Target: KLHL32 (Kelch-Like 32 (KLHL32))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHL32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: KLHL32 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHL32 Blocking Peptide, catalog no. 33R-2225, is also available for use as a blocking control in assays to test for specificity of this KLHL32 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL32 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHL32

Target: KLHL32 (Kelch-Like 32 (KLHL32))

Andere Bezeichnung: KLHL32 (KLHL32 Produkte)

Synonyme: 6430524H05Rik antikoerper, D4Ertd389e antikoerper, Gm1356 antikoerper, mKIAA1900 antikoerper, zgc:158866 antikoerper, BKLHD5 antikoerper, KIAA1900 antikoerper, UG0030H05 antikoerper, dJ21F7.1 antikoerper, RGD1310364 antikoerper, kelch like family member 32 antikoerper, kelch-like 32 antikoerper, kelch-like family member 32 antikoerper, kelch like family member 32 L homeolog antikoerper, KLHL32 antikoerper, Klhl32 antikoerper, klhl32 antikoerper, klhl32.L antikoerper

Hintergrund: The specific function of KLHL32 is not yet known.

Molekulargewicht: 70 kDa (MW of target protein)