KLHL32 Antikörper
-
- Target Alle KLHL32 Produkte
- KLHL32 (Kelch-Like 32 (KLHL32))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLHL32 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- KLHL32 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT
-
anti-Kelch-Like 32 (KLHL32) (AA 1-470) antibody
KLHL32 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Kelch-Like 32 (KLHL32) (C-Term) antibodyKLHL32 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Huhn, Affe, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Kelch-Like 32 (KLHL32) (Middle Region) antibodyKLHL32 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLHL32 Blocking Peptide, catalog no. 33R-2225, is also available for use as a blocking control in assays to test for specificity of this KLHL32 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL32 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHL32 (Kelch-Like 32 (KLHL32))
- Andere Bezeichnung
- KLHL32 (KLHL32 Produkte)
- Hintergrund
- The specific function of KLHL32 is not yet known.
- Molekulargewicht
- 70 kDa (MW of target protein)
-
