YTHDF3 Antikörper (N-Term)

Produktnummer ABIN631782

Produktdetails anti-YTHDF3 Antikörper

Target: YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser YTHDF3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: YTHDF3 antibody was raised against the N terminal of YTHDF3

Aufreinigung: Affinity purified

Immunogen: YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

YTHDF3 Blocking Peptide, catalog no. 33R-7676, is also available for use as a blocking control in assays to test for specificity of this YTHDF3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YTHDF3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu YTHDF3

Target: YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))

Andere Bezeichnung: YTHDF3 (YTHDF3 Produkte)

Synonyme: wu:fi35c09 antikoerper, zgc:55441 antikoerper, 9130022A11Rik antikoerper, YTH N6-methyladenosine RNA binding protein 3 antikoerper, YTH N(6)-methyladenosine RNA binding protein 3 antikoerper, YTH domain family 3 antikoerper, YTH N6-methyladenosine RNA binding protein 3 S homeolog antikoerper, ythdf3 antikoerper, YTHDF3 antikoerper, Ythdf3 antikoerper, ythdf3.S antikoerper

Hintergrund: YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.

Molekulargewicht: 64 kDa (MW of target protein)