POC1B Antikörper (N-Term)

Produktnummer ABIN631788

Produktdetails anti-POC1B Antikörper

Target: POC1B (POC1 Centriolar Protein Homolog B (POC1B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POC1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR51 B antibody was raised against the N terminal of WDR51

Aufreinigung: Affinity purified

Immunogen: WDR51 B antibody was raised using the N terminal of WDR51 corresponding to a region with amino acids GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR51B Blocking Peptide, catalog no. 33R-3452, is also available for use as a blocking control in assays to test for specificity of this WDR51B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POC1B

Target: POC1B (POC1 Centriolar Protein Homolog B (POC1B))

Andere Bezeichnung: WDR51B (POC1B Produkte)

Synonyme: PIX1 antikoerper, TUWD12 antikoerper, WDR51B antikoerper, 4933430F16Rik antikoerper, Wdr51b antikoerper, fl36w17 antikoerper, wdr51b antikoerper, wu:fl36w17 antikoerper, zgc:63538 antikoerper, POC1 centriolar protein B antikoerper, POC1B antikoerper, Poc1b antikoerper, poc1b antikoerper

Hintergrund: WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.

Molekulargewicht: 54 kDa (MW of target protein)