LCN8 Antikörper (N-Term)

Produktnummer ABIN631798

Produktdetails anti-LCN8 Antikörper

Target: LCN8 (Lipocalin 8 (LCN8))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCN8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Lipocalin 8 antibody was raised against the N terminal of LCN8

Aufreinigung: Affinity purified

Immunogen: Lipocalin 8 antibody was raised using the N terminal of LCN8 corresponding to a region with amino acids EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lipocalin 8 Blocking Peptide, catalog no. 33R-2370, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCN8

Target: LCN8 (Lipocalin 8 (LCN8))

Andere Bezeichnung: Lipocalin 8 (LCN8 Produkte)

Synonyme: ESP20.5 antikoerper, EP17 antikoerper, LCN5 antikoerper, 9230106L18Rik antikoerper, Lcn5 antikoerper, mEP17 antikoerper, RGD1306747 antikoerper, lipocalin 8 antikoerper, LCN8 antikoerper, Lcn8 antikoerper

Hintergrund: Members of the lipocalin family, such as LCN8, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx.

Molekulargewicht: 17 kDa (MW of target protein)