LCN8 Antikörper (N-Term)
-
- Target Alle LCN8 Antikörper anzeigen
- LCN8 (Lipocalin 8 (LCN8))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LCN8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Lipocalin 8 antibody was raised against the N terminal of LCN8
- Aufreinigung
- Affinity purified
- Immunogen
- Lipocalin 8 antibody was raised using the N terminal of LCN8 corresponding to a region with amino acids EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN
- Top Product
- Discover our top product LCN8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Lipocalin 8 Blocking Peptide, catalog no. 33R-2370, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LCN8 (Lipocalin 8 (LCN8))
- Andere Bezeichnung
- Lipocalin 8 (LCN8 Produkte)
- Hintergrund
- Members of the lipocalin family, such as LCN8, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx.
- Molekulargewicht
- 17 kDa (MW of target protein)
-