CYP26B1 Antikörper (N-Term)
-
- Target Alle CYP26B1 Antikörper anzeigen
- CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CYP26B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CYP26 B1 antibody was raised against the N terminal of CYP26 1
- Aufreinigung
- Affinity purified
- Immunogen
- CYP26 B1 antibody was raised using the N terminal of CYP26 1 corresponding to a region with amino acids LRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVF
- Top Product
- Discover our top product CYP26B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CYP26B1 Blocking Peptide, catalog no. 33R-5404, is also available for use as a blocking control in assays to test for specificity of this CYP26B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))
- Andere Bezeichnung
- CYP26B1 (CYP26B1 Produkte)
- Synonyme
- cyp26b1 antikoerper, cyp26a2 antikoerper, p450rai-2 antikoerper, CYP26A2 antikoerper, P450RAI-2 antikoerper, P450RAI2 antikoerper, RHFCA antikoerper, CP26 antikoerper, fc21d03 antikoerper, wu:fc21d03 antikoerper, wu:fc26h10 antikoerper, zgc:76999 antikoerper, cytochrome P450 26B1 antikoerper, cytochrome P450 family 26 subfamily B member 1 L homeolog antikoerper, cytochrome P450 family 26 subfamily B member 1 antikoerper, cytochrome P450, family 26, subfamily B, polypeptide 1 antikoerper, cytochrome P450, family 26, subfamily b, polypeptide 1 antikoerper, CpipJ_CPIJ002537 antikoerper, cyp26b1.L antikoerper, CYP26B1 antikoerper, cyp26b1 antikoerper, Cyp26b1 antikoerper
- Hintergrund
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Retinoic Acid Receptor Signaling Pathway, Regulation of Muscle Cell Differentiation, Monocarboxylic Acid Catabolic Process
-