LRRC57 Antikörper (N-Term)

Produktnummer ABIN631803

Produktdetails anti-LRRC57 Antikörper

Target: LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC57 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC57 antibody was raised against the N terminal of LRRC57

Aufreinigung: Affinity purified

Immunogen: LRRC57 antibody was raised using the N terminal of LRRC57 corresponding to a region with amino acids MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC57 Blocking Peptide, catalog no. 33R-6050, is also available for use as a blocking control in assays to test for specificity of this LRRC57 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC57 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC57

Target: LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))

Andere Bezeichnung: LRRC57 (LRRC57 Produkte)

Synonyme: zgc:92240 antikoerper, 2810002D13Rik antikoerper, AA407405 antikoerper, RGD1307128 antikoerper, leucine rich repeat containing 57 antikoerper, leucine rich repeat containing 57 L homeolog antikoerper, lrrc57 antikoerper, lrrc57.L antikoerper, LRRC57 antikoerper, Lrrc57 antikoerper

Hintergrund: LRRC57 is a member of the leucine-rich repeat family of proteins, which are known to be involved in protein-protein interactions.

Molekulargewicht: 27 kDa (MW of target protein)