C10ORF96 Antikörper (Middle Region)

Produktnummer ABIN631805

Produktdetails anti-C10ORF96 Antikörper

Target: C10ORF96 (C10orf96) (Chromosome 10 Open Reading Frame 96 (C10orf96))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C10ORF96 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C10 ORF96 antibody was raised against the middle region of C10 rf96

Aufreinigung: Affinity purified

Immunogen: C10 ORF96 antibody was raised using the middle region of C10 rf96 corresponding to a region with amino acids QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C10ORF96 Blocking Peptide, catalog no. 33R-7472, is also available for use as a blocking control in assays to test for specificity of this C10ORF96 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF96 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C10ORF96

Target: C10ORF96 (C10orf96) (Chromosome 10 Open Reading Frame 96 (C10orf96))

Andere Bezeichnung: C10ORF96 (C10orf96 Produkte)

Hintergrund: The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 31 kDa (MW of target protein)