AXUD1 Antikörper (Middle Region)
-
- Target Alle AXUD1 (CSRNP1) Antikörper anzeigen
- AXUD1 (CSRNP1) (Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AXUD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AXUD1 antibody was raised against the middle region of AXUD1
- Aufreinigung
- Affinity purified
- Immunogen
- AXUD1 antibody was raised using the middle region of AXUD1 corresponding to a region with amino acids ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK
- Top Product
- Discover our top product CSRNP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AXUD1 Blocking Peptide, catalog no. 33R-1498, is also available for use as a blocking control in assays to test for specificity of this AXUD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AXUD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AXUD1 (CSRNP1) (Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1))
- Andere Bezeichnung
- AXUD1 (CSRNP1 Produkte)
- Synonyme
- AXUD1 antikoerper, CSRNP-1 antikoerper, FAM130B antikoerper, TAIP-3 antikoerper, URAX1 antikoerper, 4931429D10Rik antikoerper, Axud1 antikoerper, taip-3 antikoerper, CSRNP1 antikoerper, axud1 antikoerper, MGC145297 antikoerper, fb73e11 antikoerper, wu:fb73e11 antikoerper, zgc:66340 antikoerper, cysteine and serine rich nuclear protein 1 antikoerper, cysteine-serine-rich nuclear protein 1 antikoerper, cysteine-serine-rich nuclear protein 1 L homeolog antikoerper, cysteine-serine-rich nuclear protein 1b antikoerper, CSRNP1 antikoerper, Csrnp1 antikoerper, csrnp1 antikoerper, csrnp1.L antikoerper, csrnp1b antikoerper
- Hintergrund
- This gene encodes a protein that localizes to the nucleus and expression of this gene is induced in response to elevated levels of axin. The Wnt signalling pathway, which is negatively regulated by axin, is important in axis formation in early development and impaired regulation of this signalling pathway is often involved in tumors. A decreased level of expression of this gene in tumors compared to the level of expression in their corresponding normal tissues suggests that this gene product has a tumor suppressor function.
- Molekulargewicht
- 63 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-