HIPK4 Antikörper (Middle Region)
-
- Target Alle HIPK4 Antikörper anzeigen
- HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HIPK4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HIPK4 antibody was raised against the middle region of HIPK4
- Aufreinigung
- Affinity purified
- Immunogen
- HIPK4 antibody was raised using the middle region of HIPK4 corresponding to a region with amino acids AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET
- Top Product
- Discover our top product HIPK4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HIPK4 Blocking Peptide, catalog no. 33R-1123, is also available for use as a blocking control in assays to test for specificity of this HIPK4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))
- Andere Bezeichnung
- HIPK4 (HIPK4 Produkte)
- Synonyme
- Gm162 antikoerper, homeodomain interacting protein kinase 4 antikoerper, HIPK4 antikoerper, Hipk4 antikoerper
- Hintergrund
- HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.
- Molekulargewicht
- 69 kDa (MW of target protein)
-