ALOX12 Antikörper (C-Term)
-
- Target Alle ALOX12 Antikörper anzeigen
- ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALOX12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALOX12 antibody was raised against the C terminal of ALOX12
- Aufreinigung
- Affinity purified
- Immunogen
- ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF
- Top Product
- Discover our top product ALOX12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALOX12 Blocking Peptide, catalog no. 33R-6077, is also available for use as a blocking control in assays to test for specificity of this ALOX12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))
- Andere Bezeichnung
- ALOX12 (ALOX12 Produkte)
- Synonyme
- 15-LOX-1 antikoerper, 15LOX-1 antikoerper, 12-LOX antikoerper, 12S-LOX antikoerper, LOG12 antikoerper, ALOX12 antikoerper, ALOX15 antikoerper, 9930022G08Rik antikoerper, Alox12p antikoerper, P-12LO antikoerper, 12-LO antikoerper, zgc:64120 antikoerper, wu:fb72a11 antikoerper, arachidonate 15-lipoxygenase antikoerper, arachidonate 12-lipoxygenase, 12S type antikoerper, arachidonate 12-lipoxygenase antikoerper, arachidonate 12-lipoxygenase, 12S-type antikoerper, ALOX15 antikoerper, ALOX12 antikoerper, Alox12 antikoerper, alox12 antikoerper, LOC100072916 antikoerper
- Hintergrund
- ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.
- Molekulargewicht
- 76 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-