MPV17L Antikörper (N-Term)

Produktnummer ABIN631809

Produktdetails anti-MPV17L Antikörper

Target: MPV17L (MPV17 Mitochondrial Membrane Protein-Like (MPV17L))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPV17L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MPV17 L antibody was raised against the N terminal of MPV17

Aufreinigung: Affinity purified

Immunogen: MPV17 L antibody was raised using the N terminal of MPV17 corresponding to a region with amino acids MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPV17L Blocking Peptide, catalog no. 33R-5673, is also available for use as a blocking control in assays to test for specificity of this MPV17L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPV10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPV17L

Target: MPV17L (MPV17 Mitochondrial Membrane Protein-Like (MPV17L))

Andere Bezeichnung: MPV17L (MPV17L Produkte)

Synonyme: Mpv17 antikoerper, M-LPH antikoerper, MLPH1 antikoerper, MLPH2 antikoerper, MPV17L1 antikoerper, M-LP antikoerper, MpV17 mitochondrial inner membrane protein antikoerper, MPV17 mitochondrial membrane protein-like S homeolog antikoerper, mpv17-like protein antikoerper, MPV17 mitochondrial membrane protein-like antikoerper, MPV17 mitochondrial inner membrane protein like antikoerper, Mpv17 transgene, kidney disease mutant-like antikoerper, Mpv17 antikoerper, mpv17l.S antikoerper, LOC465114 antikoerper, LOC100158680 antikoerper, MPV17L antikoerper, Mpv17l antikoerper

Hintergrund: Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Sensory Perception of Sound