ALDH1B1 Antikörper (Middle Region)
-
- Target Alle ALDH1B1 Antikörper anzeigen
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALDH1B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALDH1 B1 antibody was raised against the middle region of ALDH1 1
- Aufreinigung
- Affinity purified
- Immunogen
- ALDH1 B1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL
- Top Product
- Discover our top product ALDH1B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALDH1B1 Blocking Peptide, catalog no. 33R-3255, is also available for use as a blocking control in assays to test for specificity of this ALDH1B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
- Andere Bezeichnung
- ALDH1B1 (ALDH1B1 Produkte)
- Synonyme
- ALDH5 antikoerper, ALDHX antikoerper, rf2d antikoerper, 2700007F14Rik antikoerper, aldehyde dehydrogenase 1 family member B1 antikoerper, aldehyde dehydrogenase 5 antikoerper, aldehyde dehydrogenase 1 family, member B1 antikoerper, aldehyde dehydrogenase 3B1 antikoerper, hypothetical protein antikoerper, ALDH1B1 antikoerper, aldh5 antikoerper, Aldh1b1 antikoerper, MCYG_01035 antikoerper, MGYG_00956 antikoerper, PGTG_20239 antikoerper
- Hintergrund
- ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
- Molekulargewicht
- 57 kDa (MW of target protein)
-