KRTAP11-1 Antikörper (N-Term)
-
- Target Alle KRTAP11-1 Antikörper anzeigen
- KRTAP11-1 (Keratin Associated Protein 11-1 (KRTAP11-1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KRTAP11-1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KAP11.1 antibody was raised against the N terminal of KRTAP11-1
- Aufreinigung
- Affinity purified
- Immunogen
- KAP11.1 antibody was raised using the N terminal of KRTAP11-1 corresponding to a region with amino acids SFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSW
- Top Product
- Discover our top product KRTAP11-1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KAP11.1 Blocking Peptide, catalog no. 33R-8433, is also available for use as a blocking control in assays to test for specificity of this KAP11.1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRTAP11-1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KRTAP11-1 (Keratin Associated Protein 11-1 (KRTAP11-1))
- Andere Bezeichnung
- KAP11.1 (KRTAP11-1 Produkte)
- Hintergrund
- KRTAP11-1 belongs to the PMG family. In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
- Molekulargewicht
- 17 kDa (MW of target protein)
-