STAMBPL1 Antikörper (N-Term)
-
- Target Alle STAMBPL1 Antikörper anzeigen
- STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STAMBPL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- STAMBPL1 antibody was raised against the N terminal of STAMBPL1
- Aufreinigung
- Affinity purified
- Immunogen
- STAMBPL1 antibody was raised using the N terminal of STAMBPL1 corresponding to a region with amino acids MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR
- Top Product
- Discover our top product STAMBPL1 Primärantikörper
-
anti-STAM Binding Protein-Like 1 (STAMBPL1) (AA 135-163) antibody
STAMBPL1 Reaktivität: Human, Maus WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB26763 unconjugated
anti-STAM Binding Protein-Like 1 (STAMBPL1) antibodySTAMBPL1 Reaktivität: Human DB, ICC Wirt: Maus Monoclonal 2020C4a unconjugated
anti-STAM Binding Protein-Like 1 (STAMBPL1) (N-Term) antibodySTAMBPL1 Reaktivität: Human, Maus, Meerschweinchen, Pferd, Kaninchen, Ratte, Hund, Schwein, Fledermaus, Affe, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-STAM Binding Protein-Like 1 (STAMBPL1) (AA 120-250) antibodySTAMBPL1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-STAM Binding Protein-Like 1 (STAMBPL1) (N-Term) antibodySTAMBPL1 Reaktivität: Human, Maus, Meerschweinchen, Pferd, Kaninchen, Ratte, Hund, Rind (Kuh), Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STAMBPL1 Blocking Peptide, catalog no. 33R-5863, is also available for use as a blocking control in assays to test for specificity of this STAMBPL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAMBPL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))
- Andere Bezeichnung
- STAMBPL1 (STAMBPL1 Produkte)
- Synonyme
- amsh-lp antikoerper, MGC75962 antikoerper, MGC84444 antikoerper, AMSHLP antikoerper, DKFZp459M0218 antikoerper, 1700095N21Rik antikoerper, 8230401J17Rik antikoerper, ALMalpha antikoerper, AMSH-FP antikoerper, AMSH-LP antikoerper, bA399O19.2 antikoerper, STAM binding protein like 1 antikoerper, STAM binding protein like 1 L homeolog antikoerper, stambpl1 antikoerper, stambpl1.L antikoerper, STAMBPL1 antikoerper, Stambpl1 antikoerper
- Hintergrund
- STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.
- Molekulargewicht
- 50 kDa (MW of target protein)
-
