KIFAP3 Antikörper (Middle Region)
-
- Target Alle KIFAP3 Antikörper anzeigen
- KIFAP3 (Kinesin Associated Protein 3 (KIFAP3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIFAP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIFAP3 antibody was raised against the middle region of KIFAP3
- Aufreinigung
- Affinity purified
- Immunogen
- KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG
- Top Product
- Discover our top product KIFAP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIFAP3 Blocking Peptide, catalog no. 33R-9970, is also available for use as a blocking control in assays to test for specificity of this KIFAP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFAP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIFAP3 (Kinesin Associated Protein 3 (KIFAP3))
- Andere Bezeichnung
- KIFAP3 (KIFAP3 Produkte)
- Synonyme
- CG11759 antikoerper, DmKAP antikoerper, DmKap antikoerper, Dmel\\CG11759 antikoerper, KAP antikoerper, KAP3 antikoerper, Kap antikoerper, dKAP3 antikoerper, kap3 antikoerper, FLA3 antikoerper, KAP-1 antikoerper, KAP-3 antikoerper, SMAP antikoerper, Smg-GDS antikoerper, dJ190I16.1 antikoerper, fb99h08 antikoerper, kifap3 antikoerper, wu:fb99h08 antikoerper, wz7228 antikoerper, Kinesin associated protein 3 antikoerper, kinesin-associated protein 3 antikoerper, kinesin associated protein 3 antikoerper, kinesin-associated protein 3b antikoerper, kinesin-associated protein 3 L homeolog antikoerper, Kap3 antikoerper, LOC551999 antikoerper, KIFAP3 antikoerper, Kifap3 antikoerper, kifap3b antikoerper, kifap3.L antikoerper
- Hintergrund
- The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras, one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes.
- Molekulargewicht
- 91 kDa (MW of target protein)
- Pathways
- Hedgehog Signalweg, Sensory Perception of Sound
-