ZFP14 Antikörper (N-Term)

Produktnummer ABIN631822

Produktdetails anti-ZFP14 Antikörper

Target: ZFP14 (Zinc Finger Protein 14 Homolog (ZFP14))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZFP14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZNF14 antibody was raised against the N terminal of ZNF14

Aufreinigung: Affinity purified

Immunogen: ZNF14 antibody was raised using the N terminal of ZNF14 corresponding to a region with amino acids IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZNF14 Blocking Peptide, catalog no. 33R-4231, is also available for use as a blocking control in assays to test for specificity of this ZNF14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZFP14

Target: ZFP14 (Zinc Finger Protein 14 Homolog (ZFP14))

Andere Bezeichnung: ZNF14 (ZFP14 Produkte)

Synonyme: ZNF531 antikoerper, Hit40 antikoerper, Znf14 antikoerper, GIOT-4 antikoerper, KOX6 antikoerper, 4732429I09Rik antikoerper, Krox-9 antikoerper, Zfp-14 antikoerper, mKIAA1559 antikoerper, Zfp968 antikoerper, ZFP14 zinc finger protein antikoerper, zinc finger protein 709 antikoerper, zinc finger protein 14 antikoerper, ZFP14 antikoerper, Zfp709 antikoerper, ZNF14 antikoerper, Zfp14 antikoerper

Hintergrund: ZNF14 contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins.

Molekulargewicht: 71 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin