ZFP14 Antikörper (N-Term)
-
- Target Alle ZFP14 Antikörper anzeigen
- ZFP14 (Zinc Finger Protein 14 Homolog (ZFP14))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZFP14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZNF14 antibody was raised against the N terminal of ZNF14
- Aufreinigung
- Affinity purified
- Immunogen
- ZNF14 antibody was raised using the N terminal of ZNF14 corresponding to a region with amino acids IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC
- Top Product
- Discover our top product ZFP14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZNF14 Blocking Peptide, catalog no. 33R-4231, is also available for use as a blocking control in assays to test for specificity of this ZNF14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZFP14 (Zinc Finger Protein 14 Homolog (ZFP14))
- Andere Bezeichnung
- ZNF14 (ZFP14 Produkte)
- Hintergrund
- ZNF14 contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins.
- Molekulargewicht
- 71 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin
-