MUC3B Antikörper (N-Term)
-
- Target Alle MUC3B Produkte
- MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MUC3B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MUC3 B antibody was raised against the N terminal of MUC3
- Aufreinigung
- Affinity purified
- Immunogen
- MUC3 B antibody was raised using the N terminal of MUC3 corresponding to a region with amino acids KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MUC3B Blocking Peptide, catalog no. 33R-4649, is also available for use as a blocking control in assays to test for specificity of this MUC3B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))
- Andere Bezeichnung
- MUC3B (MUC3B Produkte)
- Hintergrund
- MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
- Molekulargewicht
- 34 kDa (MW of target protein)
-