MUC3B Antikörper (N-Term)

Produktnummer ABIN631826

Produktdetails anti-MUC3B Antikörper

Target: MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MUC3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MUC3 B antibody was raised against the N terminal of MUC3

Aufreinigung: Affinity purified

Immunogen: MUC3 B antibody was raised using the N terminal of MUC3 corresponding to a region with amino acids KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MUC3B Blocking Peptide, catalog no. 33R-4649, is also available for use as a blocking control in assays to test for specificity of this MUC3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MUC3B

Target: MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))

Andere Bezeichnung: MUC3B (MUC3B Produkte)

Synonyme: MUC3 antikoerper, MUC3A antikoerper, MUC3B antikoerper, mucin 3B, cell surface associated antikoerper, mucin-3B antikoerper, MUC3B antikoerper, LOC463613 antikoerper

Hintergrund: MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Molekulargewicht: 34 kDa (MW of target protein)