Sec23 Homolog B Antikörper

Produktnummer ABIN631828

Produktdetails anti-Sec23 Homolog B Antikörper

Target: Sec23 Homolog B (SEC23B)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sec23 Homolog B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SEC23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SEC23B Blocking Peptide, catalog no. 33R-8439, is also available for use as a blocking control in assays to test for specificity of this SEC23B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Sec23 Homolog B

Target: Sec23 Homolog B (SEC23B)

Andere Bezeichnung: SEC23B (SEC23B Produkte)

Synonyme: CDA-II antikoerper, CDAII antikoerper, CDAN2 antikoerper, HEMPAS antikoerper, wu:fd19h01 antikoerper, wu:fl08h02 antikoerper, zgc:55595 antikoerper, zgc:86871 antikoerper, SEC23A antikoerper, Sec23 homolog B, COPII coat complex component L homeolog antikoerper, Sec23 homolog B, coat complex II component antikoerper, Sec23 homolog B, COPII coat complex component antikoerper, SEC23 homolog B, COPII coat complex component antikoerper, sec23b.L antikoerper, SEC23B antikoerper, sec23b antikoerper, Sec23b antikoerper

Hintergrund: SEC23B is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. SEC23B has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function SEC23B has been implicated in cargo selection and concentration.

Molekulargewicht: 86 kDa (MW of target protein)