TMPRSS3 Antikörper (N-Term)
-
- Target Alle TMPRSS3 Antikörper anzeigen
- TMPRSS3 (Transmembrane Protease, Serine 3 (TMPRSS3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMPRSS3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMPRSS3 antibody was raised against the N terminal of TMPRSS3
- Aufreinigung
- Affinity purified
- Immunogen
- TMPRSS3 antibody was raised using the N terminal of TMPRSS3 corresponding to a region with amino acids MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP
- Top Product
- Discover our top product TMPRSS3 Primärantikörper
-
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (Internal Region) antibody
TMPRSS3 Reaktivität: Human, Maus WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (N-Term) antibodyTMPRSS3 Reaktivität: Human, Maus, Ratte, Pferd, Hund, Meerschweinchen, Rind (Kuh), Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (C-Term) antibodyTMPRSS3 Reaktivität: Human WB, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (AA 272-300) antibodyTMPRSS3 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal RB21838 unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (AA 119-214) antibodyTMPRSS3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2E1 unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (C-Term) antibodyTMPRSS3 Reaktivität: Human WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (C-Term) antibodyTMPRSS3 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (C-Term) antibodyTMPRSS3 Reaktivität: Human, Maus WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (AA 420-460) antibodyTMPRSS3 Reaktivität: Human, Maus WB, IHC, IF, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Protease, Serine 3 (TMPRSS3) (Internal Region) antibodyVerified TMPRSS3 Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMPRSS3 Blocking Peptide, catalog no. 33R-6022, is also available for use as a blocking control in assays to test for specificity of this TMPRSS3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMPRSS3 (Transmembrane Protease, Serine 3 (TMPRSS3))
- Andere Bezeichnung
- TMPRSS3 (TMPRSS3 Produkte)
- Synonyme
- TMPRSS3 antikoerper, DKFZp469L1528 antikoerper, DFNB10 antikoerper, DFNB8 antikoerper, ECHOS1 antikoerper, TADG12 antikoerper, transmembrane protease, serine 3 antikoerper, TMPRSS3 antikoerper, Tmprss3 antikoerper
- Hintergrund
- This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-
