PRRC1 Antikörper (Middle Region)
-
- Target Alle PRRC1 Antikörper anzeigen
- PRRC1 (Proline-Rich Coiled-Coil 1 (PRRC1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRRC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRRC1 antibody was raised against the middle region of PRRC1
- Aufreinigung
- Affinity purified
- Immunogen
- PRRC1 antibody was raised using the middle region of PRRC1 corresponding to a region with amino acids VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIA
- Top Product
- Discover our top product PRRC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRRC1 Blocking Peptide, catalog no. 33R-9551, is also available for use as a blocking control in assays to test for specificity of this PRRC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRRC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRRC1 (Proline-Rich Coiled-Coil 1 (PRRC1))
- Andere Bezeichnung
- PRRC1 (PRRC1 Produkte)
- Synonyme
- MGC75910 antikoerper, SAG20 antikoerper, fi37a08 antikoerper, id:ibd5136 antikoerper, mys antikoerper, t2gtl20 antikoerper, wu:fi37a08 antikoerper, zgc:103484 antikoerper, prrc1 antikoerper, 1190002C06Rik antikoerper, 2310058D16Rik antikoerper, 3110038B19Rik antikoerper, 9430085A19Rik antikoerper, Prcc1 antikoerper, proline-rich coiled-coil 1 antikoerper, proline-rich coiled-coil 1 S homeolog antikoerper, proline rich coiled-coil 1 antikoerper, prrc1 antikoerper, prrc1.S antikoerper, PRRC1 antikoerper, Prrc1 antikoerper
- Hintergrund
- The specific function of PRRC1 is not yet known.
- Molekulargewicht
- 47 kDa (MW of target protein)
-