DCXR Antikörper (Middle Region)

Produktnummer ABIN631837

Produktdetails anti-DCXR Antikörper

Target: DCXR (Dicarbonyl/L-Xylulose Reductase (DCXR))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCXR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: DCXR antibody was raised against the middle region of DCXR

Aufreinigung: Affinity purified

Immunogen: DCXR antibody was raised using the middle region of DCXR corresponding to a region with amino acids STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DCXR Blocking Peptide, catalog no. 33R-8869, is also available for use as a blocking control in assays to test for specificity of this DCXR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCXR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCXR

Target: DCXR (Dicarbonyl/L-Xylulose Reductase (DCXR))

Andere Bezeichnung: DCXR (DCXR Produkte)

Synonyme: DCR antikoerper, HCR2 antikoerper, HCRII antikoerper, KIDCR antikoerper, P34H antikoerper, SDR20C1 antikoerper, XR antikoerper, dcxr antikoerper, DCXR antikoerper, DER antikoerper, 0610038K04Rik antikoerper, 1810027P18Rik antikoerper, glb antikoerper, wu:fa12f09 antikoerper, zgc:111977 antikoerper, GLB antikoerper, dicarbonyl and L-xylulose reductase antikoerper, dicarbonyl/L-xylulose reductase antikoerper, dicarbonyl L-xylulose reductase antikoerper, L-xylulose reductase antikoerper, L-xylulose reductase, putative antikoerper, dicarbonyl/L-xylulose reductase L homeolog antikoerper, DCXR antikoerper, dcxr antikoerper, Dcxr antikoerper, CNL05930 antikoerper, NCU09041 antikoerper, AOR_1_494194 antikoerper, VDBG_02657 antikoerper, CGB_D1070C antikoerper, dcxr.L antikoerper

Hintergrund: DCXR is an enzyme that has both diacetyl reductase and L-xylulose reductase activities.DCXR is an enzyme that has both diacetyl reductase (EC 1.1.1.5) and L-xylulose reductase (EC 1.1.1.10) activities.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Monocarboxylic Acid Catabolic Process