ENKD1 Antikörper (C-Term)

Produktnummer ABIN631839

Produktdetails anti-ENKD1 Antikörper

Target: ENKD1 (Enkurin Domain Containing 1 (ENKD1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ENKD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C16 ORF48 antibody was raised against the C terminal Of C16 rf48

Aufreinigung: Affinity purified

Immunogen: C16 ORF48 antibody was raised using the C terminal Of C16 rf48 corresponding to a region with amino acids DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C16ORF48 Blocking Peptide, catalog no. 33R-2073, is also available for use as a blocking control in assays to test for specificity of this C16ORF48 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF48 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ENKD1

Target: ENKD1 (Enkurin Domain Containing 1 (ENKD1))

Andere Bezeichnung: C16ORF48 (ENKD1 Produkte)

Synonyme: C16orf48 antikoerper, DAKV6410 antikoerper, C18H16orf48 antikoerper, AI606951 antikoerper, E130303B06Rik antikoerper, enkurin domain containing 1 antikoerper, ENKD1 antikoerper, Enkd1 antikoerper

Hintergrund: The function of C16orf48 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 39 kDa (MW of target protein)