C7orf31 Antikörper (N-Term)

Produktnummer ABIN631840

Produktdetails anti-C7orf31 Antikörper

Target: C7orf31 (Chromosome 7 Open Reading Frame 31 (C7orf31))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C7orf31 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C7 ORF31 antibody was raised against the N terminal Of C7 rf31

Aufreinigung: Affinity purified

Immunogen: C7 ORF31 antibody was raised using the N terminal Of C7 rf31 corresponding to a region with amino acids EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C7ORF31 Blocking Peptide, catalog no. 33R-2789, is also available for use as a blocking control in assays to test for specificity of this C7ORF31 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF31 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C7orf31

Target: C7orf31 (Chromosome 7 Open Reading Frame 31 (C7orf31))

Andere Bezeichnung: C7ORF31 (C7orf31 Produkte)

Synonyme: C7orf31 antikoerper, chromosome 7 open reading frame 31 antikoerper, chromosome 2 C7orf31 homolog antikoerper, uncharacterized protein C7orf31 antikoerper, C7orf31 antikoerper, C2H7orf31 antikoerper, LOC702969 antikoerper

Hintergrund: The function of C7orf31 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 68 kDa (MW of target protein)