C7orf31 Antikörper (N-Term)
-
- Target Alle C7orf31 Produkte
- C7orf31 (Chromosome 7 Open Reading Frame 31 (C7orf31))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C7orf31 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C7 ORF31 antibody was raised against the N terminal Of C7 rf31
- Aufreinigung
- Affinity purified
- Immunogen
- C7 ORF31 antibody was raised using the N terminal Of C7 rf31 corresponding to a region with amino acids EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C7ORF31 Blocking Peptide, catalog no. 33R-2789, is also available for use as a blocking control in assays to test for specificity of this C7ORF31 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF31 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C7orf31 (Chromosome 7 Open Reading Frame 31 (C7orf31))
- Andere Bezeichnung
- C7ORF31 (C7orf31 Produkte)
- Synonyme
- C7orf31 antikoerper, chromosome 7 open reading frame 31 antikoerper, chromosome 2 C7orf31 homolog antikoerper, uncharacterized protein C7orf31 antikoerper, C7orf31 antikoerper, C2H7orf31 antikoerper, LOC702969 antikoerper
- Hintergrund
- The function of C7orf31 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 68 kDa (MW of target protein)
-