Phosphoglucomutase 3 Antikörper (Middle Region)
-
- Target Alle Phosphoglucomutase 3 (PGM3) Antikörper anzeigen
- Phosphoglucomutase 3 (PGM3)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Phosphoglucomutase 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PGM3 antibody was raised against the middle region of PGM3
- Aufreinigung
- Affinity purified
- Immunogen
- PGM3 antibody was raised using the middle region of PGM3 corresponding to a region with amino acids GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN
- Top Product
- Discover our top product PGM3 Primärantikörper
-
anti-Phosphoglucomutase 3 (PGM3) (AA 1-542) antibody
PGM3 Reaktivität: Human WB, ELISA, IHC (p), IP, RNAi Wirt: Maus Monoclonal 1E2-1B12 unconjugated
anti-Phosphoglucomutase 3 (PGM3) antibodyPGM3 Reaktivität: Human, Maus, Affe WB, IHC, FACS, IHC (p) Wirt: Maus Monoclonal 1A11 unconjugated
anti-Phosphoglucomutase 3 (PGM3) antibodyPGM3 Reaktivität: Human WB, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphoglucomutase 3 (PGM3) (AA 1-542) antibodyPGM3 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Phosphoglucomutase 3 (PGM3) (AA 237-263) antibodyPGM3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB39616 unconjugated
anti-Phosphoglucomutase 3 (PGM3) (AA 1-542) antibodyPGM3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphoglucomutase 3 (PGM3) (AA 1-300) antibodyPGM3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphoglucomutase 3 (PGM3) (AA 323-372) antibodyPGM3 Reaktivität: Human, Maus, Ratte, Kaninchen, Hund, Rind (Kuh), Meerschweinchen, Pferd, Affe, Schwein, Xenopus laevis, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphoglucomutase 3 (PGM3) (AA 107-156) antibodyPGM3 Reaktivität: Human, Maus, Ratte, Kaninchen, Hund, Zebrafisch (Danio rerio), Affe, Fledermaus, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphoglucomutase 3 (PGM3) (N-Term) antibodyPGM3 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PGM3 Blocking Peptide, catalog no. 33R-3660, is also available for use as a blocking control in assays to test for specificity of this PGM3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Phosphoglucomutase 3 (PGM3)
- Andere Bezeichnung
- PGM3 (PGM3 Produkte)
- Synonyme
- pgm3 antikoerper, MGC69105 antikoerper, wu:fc08c11 antikoerper, wu:fc39c03 antikoerper, zgc:91932 antikoerper, PGM3 antikoerper, AGM1 antikoerper, PAGM antikoerper, PGM 3 antikoerper, 2810473H05Rik antikoerper, Agm1 antikoerper, BB187688 antikoerper, C77933 antikoerper, Pgm-3 antikoerper, phosphoglucomutase 3 L homeolog antikoerper, phosphoglucomutase 3 antikoerper, phosphoacetylglucosamine mutase antikoerper, pgm3.L antikoerper, PGM3 antikoerper, pgm3 antikoerper, PGTG_05011 antikoerper, Pgm3 antikoerper
- Hintergrund
- PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.
- Molekulargewicht
- 60 kDa (MW of target protein)
-
