SKA3 Antikörper (Middle Region)

Produktnummer ABIN631843

Produktdetails anti-SKA3 Antikörper

Target: SKA3 (Spindle and Kinetochore Associated Complex Subunit 3 (SKA3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SKA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SKA3 antibody was raised against the middle region of SKA3

Aufreinigung: Affinity purified

Immunogen: SKA3 antibody was raised using the middle region of SKA3 corresponding to a region with amino acids EVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SKA3 Blocking Peptide, catalog no. 33R-2779, is also available for use as a blocking control in assays to test for specificity of this SKA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SKA3

Target: SKA3 (Spindle and Kinetochore Associated Complex Subunit 3 (SKA3))

Andere Bezeichnung: SKA3 (SKA3 Produkte)

Synonyme: C13orf3 antikoerper, RAMA1 antikoerper, RGD1307201 antikoerper, C12H13ORF3 antikoerper, fc23d11 antikoerper, si:rp71-68n21.13 antikoerper, wu:fc23d11 antikoerper, rama1 antikoerper, F630043A04Rik antikoerper, spindle and kinetochore associated complex subunit 3 antikoerper, spindle and kinetochore associated complex subunit 3 L homeolog antikoerper, SKA3 antikoerper, Ska3 antikoerper, ska3 antikoerper, ska3.L antikoerper

Hintergrund: This protein is a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromosome segregation and cell division. Alternative splicing results in multiple transcript variants.

Molekulargewicht: 46 kDa (MW of target protein)