GNPDA1 Antikörper (C-Term)
-
- Target Alle GNPDA1 Antikörper anzeigen
- GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Maus, Human, Ratte, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNPDA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GNPDA1 antibody was raised against the C terminal of GNPDA1
- Aufreinigung
- Affinity purified
- Immunogen
- GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD
- Top Product
- Discover our top product GNPDA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GNPDA1 Blocking Peptide, catalog no. 33R-2449, is also available for use as a blocking control in assays to test for specificity of this GNPDA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNPDA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))
- Andere Bezeichnung
- GNPDA1 (GNPDA1 Produkte)
- Hintergrund
- GNPDA1 belongs to the glucosamine/galactosamine-6-phosphate isomerase family.It seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.
- Molekulargewicht
- 33 kDa (MW of target protein)
-