ROPN1B Antikörper (N-Term)
-
- Target Alle ROPN1B Antikörper anzeigen
- ROPN1B (Ropporin, Rhophilin Associated Protein 1B (ROPN1B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ROPN1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ROPN1 B antibody was raised against the N terminal of ROPN1
- Aufreinigung
- Affinity purified
- Immunogen
- ROPN1 B antibody was raised using the N terminal of ROPN1 corresponding to a region with amino acids DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE
- Top Product
- Discover our top product ROPN1B Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ROPN1B Blocking Peptide, catalog no. 33R-2236, is also available for use as a blocking control in assays to test for specificity of this ROPN1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROPN0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ROPN1B (Ropporin, Rhophilin Associated Protein 1B (ROPN1B))
- Andere Bezeichnung
- ROPN1B (ROPN1B Produkte)
- Hintergrund
- ROPN1B belongs to the ropporin family and contains 1 RIIa domain. ROPN1B interacts with RHPN1 and AKAP3. It may interact with SPA17.
- Molekulargewicht
- 24 kDa (MW of target protein)
-