AASDH Antikörper (Middle Region)

Produktnummer ABIN631854

Produktdetails anti-AASDH Antikörper

Target: AASDH (Aminoadipate-Semialdehyde Dehydrogenase (AASDH))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AASDH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AASDH antibody was raised against the middle region of AASDH

Aufreinigung: Affinity purified

Immunogen: AASDH antibody was raised using the middle region of AASDH corresponding to a region with amino acids TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AASDH Blocking Peptide, catalog no. 33R-9009, is also available for use as a blocking control in assays to test for specificity of this AASDH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AASDH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AASDH

Target: AASDH (Aminoadipate-Semialdehyde Dehydrogenase (AASDH))

Andere Bezeichnung: AASDH (AASDH Produkte)

Synonyme: u26 antikoerper, ACSF4 antikoerper, LYS2 antikoerper, NRPS1098 antikoerper, NRPS998 antikoerper, A230062G08Rik antikoerper, A830035E16 antikoerper, Acsf4 antikoerper, U26 antikoerper, RGD1311135 antikoerper, si:dkeyp-117h8.3 antikoerper, aminoadipate-semialdehyde dehydrogenase antikoerper, Aminoadipate-semialdehyde dehydrogenase, putative antikoerper, AASDH antikoerper, aasdh antikoerper, lys1 antikoerper, CNG00170 antikoerper, CC1G_15694 antikoerper, CGB_G6500C antikoerper, Aasdh antikoerper

Hintergrund: Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA.

Molekulargewicht: 122 kDa (MW of target protein)