FAM83B Antikörper (C-Term)

Produktnummer ABIN631856

Produktdetails anti-FAM83B Antikörper

Target: FAM83B (Family with Sequence Similarity 83, Member B (FAM83B))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM83B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM83 B antibody was raised against the C terminal of FAM83

Aufreinigung: Affinity purified

Immunogen: FAM83 B antibody was raised using the C terminal of FAM83 corresponding to a region with amino acids PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM83B Blocking Peptide, catalog no. 33R-7342, is also available for use as a blocking control in assays to test for specificity of this FAM83B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM83B

Target: FAM83B (Family with Sequence Similarity 83, Member B (FAM83B))

Andere Bezeichnung: FAM83B (FAM83B Produkte)

Synonyme: fam83b antikoerper, C6orf143 antikoerper, C530008M07Rik antikoerper, Gm516 antikoerper, family with sequence similarity 83, member B antikoerper, family with sequence similarity 83 member B antikoerper, fam83b antikoerper, FAM83B antikoerper, Fam83b antikoerper

Hintergrund: The function of FAM83B protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 115 kDa (MW of target protein)