CENPI Antikörper (N-Term)

Produktnummer ABIN631857

Produktdetails anti-CENPI Antikörper

Target: CENPI (Centromere Protein I (CENPI))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CENPI Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CENPI antibody was raised against the N terminal of CENPI

Aufreinigung: Affinity purified

Immunogen: CENPI antibody was raised using the N terminal of CENPI corresponding to a region with amino acids SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CENPI Blocking Peptide, catalog no. 33R-8690, is also available for use as a blocking control in assays to test for specificity of this CENPI antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPI antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CENPI

Target: CENPI (Centromere Protein I (CENPI))

Andere Bezeichnung: CENPI (CENPI Produkte)

Synonyme: im:7159077 antikoerper, wu:fi32d01 antikoerper, CENP-I antikoerper, FSHPRH1 antikoerper, LRPR1 antikoerper, Mis6 antikoerper, AI504163 antikoerper, Fshprh1 antikoerper, RNALRP antikoerper, centromere protein I antikoerper, CENPI antikoerper, cenpi antikoerper, Cenpi antikoerper

Hintergrund: CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Molekulargewicht: 87 kDa (MW of target protein)