KANK3 Antikörper (N-Term)

Produktnummer ABIN631860

Produktdetails anti-KANK3 Antikörper

Target: KANK3 (KN Motif and Ankyrin Repeat Domains 3 (KANK3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KANK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ANKRD47 antibody was raised against the N terminal Of Ankrd47

Aufreinigung: Affinity purified

Immunogen: ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKRD47 Blocking Peptide, catalog no. 33R-3467, is also available for use as a blocking control in assays to test for specificity of this ANKRD47 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD47 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KANK3

Target: KANK3 (KN Motif and Ankyrin Repeat Domains 3 (KANK3))

Andere Bezeichnung: ANKRD47 (KANK3 Produkte)

Synonyme: ANKRD47 antikoerper, 0610013D04Rik antikoerper, Ankrd47 antikoerper, D17Ertd288e antikoerper, NG28 antikoerper, RGD1308853 antikoerper, KN motif and ankyrin repeat domains 3 antikoerper, KANK3 antikoerper, Kank3 antikoerper

Hintergrund: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 86 kDa (MW of target protein)