DPPA4 Antikörper (N-Term)

Produktnummer ABIN631866

Produktdetails anti-DPPA4 Antikörper

Target: DPPA4 (Developmental Pluripotency Associated 4 (DPPA4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPPA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DPPA4 antibody was raised against the N terminal of DPPA4

Aufreinigung: Affinity purified

Immunogen: DPPA4 antibody was raised using the N terminal of DPPA4 corresponding to a region with amino acids MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPPA4 Blocking Peptide, catalog no. 33R-6210, is also available for use as a blocking control in assays to test for specificity of this DPPA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPPA4

Target: DPPA4 (Developmental Pluripotency Associated 4 (DPPA4))

Andere Bezeichnung: DPPA4 (DPPA4 Produkte)

Synonyme: 2410091M23Rik antikoerper, C76608 antikoerper, ECAT15-1 antikoerper, DPPA4 antikoerper, Dppa4 antikoerper, developmental pluripotency associated 4 antikoerper, DppA4 antikoerper, peptide ABC transporter substrate-binding protein antikoerper, dipeptide ABC transport system, substrate-binding protein antikoerper, similar to developmental pluripotency associated 4 isoform 1 antikoerper, DPPA4 antikoerper, Dppa4 antikoerper, dppA4 antikoerper, HVO_RS14920 antikoerper, LOC100360556 antikoerper, LOC683300 antikoerper

Hintergrund: DPPA4 may play a role in maintaining cell pluripotentiality.

Molekulargewicht: 33 kDa (MW of target protein)