C1orf55 Antikörper (C-Term)
-
- Target Alle C1orf55 Produkte
- C1orf55 (Chromosome 1 Open Reading Frame 55 (C1orf55))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C1orf55 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C1 ORF55 antibody was raised against the C terminal Of C1 rf55
- Aufreinigung
- Affinity purified
- Immunogen
- C1 ORF55 antibody was raised using the C terminal Of C1 rf55 corresponding to a region with amino acids AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C1ORF55 Blocking Peptide, catalog no. 33R-1180, is also available for use as a blocking control in assays to test for specificity of this C1ORF55 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF55 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1orf55 (Chromosome 1 Open Reading Frame 55 (C1orf55))
- Andere Bezeichnung
- C1ORF55 (C1orf55 Produkte)
- Synonyme
- C1orf55 antikoerper, RP4-671D7.1 antikoerper, dJ671D7.1 antikoerper, SDE2 antikoerper, c1orf55 antikoerper, DKFZp469F1217 antikoerper, RGD1305572 antikoerper, wu:fb55e02 antikoerper, wu:fi34c02 antikoerper, zgc:112095 antikoerper, SDE2 telomere maintenance homolog antikoerper, SDE2 telomere maintenance homolog (S. pombe) S homeolog antikoerper, SDE2 telomere maintenance homolog (S. pombe) antikoerper, SDE2 antikoerper, sde2.S antikoerper, sde2 antikoerper, Sde2 antikoerper
- Hintergrund
- C1orf55 is phosphorylated upon DNA damage, probably by ATM or ATR. The exact function of C1orf55 remains unknown.
- Molekulargewicht
- 50 kDa (MW of target protein)
-