C21ORF45 Antikörper (N-Term)
MIS18A
Reaktivität: Human
WB
Wirt: Kaninchen
Polyclonal
unconjugated
1 image
-
- Target Alle C21ORF45 (MIS18A) Antikörper anzeigen
- C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))
- Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C21ORF45 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C21 ORF45 antibody was raised against the N terminal Of C21 rf45
- Aufreinigung
- Affinity purified
- Immunogen
- C21 ORF45 antibody was raised using the N terminal Of C21 rf45 corresponding to a region with amino acids MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS
- Top Product
- Discover our top product MIS18A Primärantikörper
-
anti-MIS18 Kinetochore Protein Homolog A (MIS18A) (N-Term) antibody
MIS18A Reaktivität: Human, Ratte, Kaninchen, Rind (Kuh), Hund, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C21ORF45 Blocking Peptide, catalog no. 33R-5672, is also available for use as a blocking control in assays to test for specificity of this C21ORF45 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF45 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))
- Andere Bezeichnung
- C21ORF45 (MIS18A Produkte)
- Hintergrund
- C21ORF45 is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.
- Molekulargewicht
- 26 kDa (MW of target protein)
-
Sie sind hier:
