C21ORF45 Antikörper (N-Term)

Produktnummer ABIN631868

Produktdetails anti-C21ORF45 Antikörper

Target: C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C21ORF45 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C21 ORF45 antibody was raised against the N terminal Of C21 rf45

Aufreinigung: Affinity purified

Immunogen: C21 ORF45 antibody was raised using the N terminal Of C21 rf45 corresponding to a region with amino acids MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C21ORF45 Blocking Peptide, catalog no. 33R-5672, is also available for use as a blocking control in assays to test for specificity of this C21ORF45 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF45 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C21ORF45

Target: C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))

Andere Bezeichnung: C21ORF45 (MIS18A Produkte)

Synonyme: B28 antikoerper, C21orf45 antikoerper, C21orf46 antikoerper, FASP1 antikoerper, MIS18alpha antikoerper, hMis18alpha antikoerper, 2610039C10Rik antikoerper, 2810018N07Rik antikoerper, RGD1310778 antikoerper, MIS18 kinetochore protein A antikoerper, MIS18A antikoerper, Mis18a antikoerper

Hintergrund: C21ORF45 is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.

Molekulargewicht: 26 kDa (MW of target protein)