MORN4 Antikörper (Middle Region)
-
- Target Alle MORN4 Antikörper anzeigen
- MORN4 (MORN Repeat Containing 4 (MORN4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MORN4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C10 ORF83 antibody was raised against the middle region of C10 rf83
- Aufreinigung
- Affinity purified
- Immunogen
- C10 ORF83 antibody was raised using the middle region of C10 rf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA
- Top Product
- Discover our top product MORN4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C10ORF83 Blocking Peptide, catalog no. 33R-2907, is also available for use as a blocking control in assays to test for specificity of this C10ORF83 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF83 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MORN4 (MORN Repeat Containing 4 (MORN4))
- Andere Bezeichnung
- C10ORF83 (MORN4 Produkte)
- Synonyme
- zgc:113281 antikoerper, DKFZp459E156 antikoerper, C10orf83 antikoerper, bA548K23.4 antikoerper, C10ORF83 antikoerper, C26H10orf83 antikoerper, RGD1307336 antikoerper, MORN repeat containing 4 antikoerper, MORN4 antikoerper, morn4 antikoerper, Morn4 antikoerper
- Hintergrund
- The function of C10orf83 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 16 kDa (MW of target protein)
-