OSCP1 Antikörper (N-Term)

Produktnummer ABIN631871

Produktdetails anti-OSCP1 Antikörper

Target: OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OSCP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF102 antibody was raised against the N terminal Of C1 rf102

Aufreinigung: Affinity purified

Immunogen: C1 ORF102 antibody was raised using the N terminal Of C1 rf102 corresponding to a region with amino acids MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF102 Blocking Peptide, catalog no. 33R-6525, is also available for use as a blocking control in assays to test for specificity of this C1ORF102 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF102 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OSCP1

Target: OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))

Andere Bezeichnung: C1ORF102 (OSCP1 Produkte)

Hintergrund: C1ORF102 may be involved in drug clearance in the placenta.

Molekulargewicht: 43 kDa (MW of target protein)