CDKL2 Antikörper
-
- Target Alle CDKL2 Antikörper anzeigen
- CDKL2 (Cyclin Dependent Kinase Like 2 (CDKL2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDKL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CDKL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR
- Top Product
- Discover our top product CDKL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDKL2 Blocking Peptide, catalog no. 33R-5933, is also available for use as a blocking control in assays to test for specificity of this CDKL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDKL2 (Cyclin Dependent Kinase Like 2 (CDKL2))
- Andere Bezeichnung
- CDKL2 (CDKL2 Produkte)
- Synonyme
- KKIAMRE antikoerper, P56 antikoerper, CDKL2 antikoerper, 5330436L21Rik antikoerper, AI505225 antikoerper, Kkm antikoerper, DKFZp459L235 antikoerper, kkiamre antikoerper, cyclin dependent kinase like 2 antikoerper, cyclin-dependent kinase-like 2 (CDC2-related kinase) antikoerper, cyclin dependent kinase like 2 L homeolog antikoerper, CDKL2 antikoerper, Cdkl2 antikoerper, cdkl2.L antikoerper
- Hintergrund
- This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.
- Molekulargewicht
- 54 kDa (MW of target protein)
-