PYCR2 Antikörper (C-Term)

Produktnummer ABIN631887

Produktdetails anti-PYCR2 Antikörper

Target: PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PYCR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PYCR2 antibody was raised against the C terminal of PYCR2

Aufreinigung: Affinity purified

Immunogen: PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PYCR2 Blocking Peptide, catalog no. 33R-5055, is also available for use as a blocking control in assays to test for specificity of this PYCR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PYCR2

Target: PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))

Andere Bezeichnung: PYCR2 (PYCR2 Produkte)

Synonyme: p5c antikoerper, p5cr antikoerper, pro3 antikoerper, pycr antikoerper, pig45 antikoerper, pp222 antikoerper, pycr2 antikoerper, arcl2b antikoerper, P5CR2 antikoerper, 1810018M05Rik antikoerper, P5cr2 antikoerper, pyrroline-5-carboxylate reductase 2 antikoerper, pyrroline-5-carboxylate reductase family, member 1 antikoerper, pyrroline-5-carboxylate reductase 1 antikoerper, pyrroline-5-carboxylate reductase family, member 2 antikoerper, pyrroline-5-carboxylate reductase 1b antikoerper, PYCR2 antikoerper, pycr1 antikoerper, PYCR1 antikoerper, Pycr2 antikoerper, pycr1b antikoerper

Hintergrund: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

Molekulargewicht: 34 kDa (MW of target protein)