DNALI1 Antikörper (N-Term)
-
- Target Alle DNALI1 Antikörper anzeigen
- DNALI1 (Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNALI1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DNALI1 antibody was raised against the N terminal of DNALI1
- Aufreinigung
- Affinity purified
- Immunogen
- DNALI1 antibody was raised using the N terminal of DNALI1 corresponding to a region with amino acids MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA
- Top Product
- Discover our top product DNALI1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNALI1 Blocking Peptide, catalog no. 33R-6612, is also available for use as a blocking control in assays to test for specificity of this DNALI1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNALI1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNALI1 (Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1))
- Andere Bezeichnung
- DNALI1 (DNALI1 Produkte)
- Synonyme
- zgc:171493 antikoerper, zgc:171595 antikoerper, P28 antikoerper, dJ423B22.5 antikoerper, hp28 antikoerper, 1700023A09Rik antikoerper, AW049135 antikoerper, dynein axonemal light intermediate chain 1 antikoerper, dynein, axonemal, light intermediate chain 1 antikoerper, dynein axonemal light intermediate chain 1 S homeolog antikoerper, dynein, axonemal, light intermediate polypeptide 1 antikoerper, DNALI1 antikoerper, dnali1 antikoerper, dnali1.S antikoerper, Dnali1 antikoerper
- Hintergrund
- DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.
- Molekulargewicht
- 31 kDa (MW of target protein)
-