C19orf47 Antikörper (C-Term)

Produktnummer ABIN631889

Produktdetails anti-C19orf47 Antikörper

Target: C19orf47 (Chromosome 19 Open Reading Frame 47 (C19orf47))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C19orf47 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C19 ORF47 antibody was raised against the C terminal Of C19 rf47

Aufreinigung: Affinity purified

Immunogen: C19 ORF47 antibody was raised using the C terminal Of C19 rf47 corresponding to a region with amino acids DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKR

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF47 Blocking Peptide, catalog no. 33R-2176, is also available for use as a blocking control in assays to test for specificity of this C19ORF47 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF47 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C19orf47

Target: C19orf47 (Chromosome 19 Open Reading Frame 47 (C19orf47))

Andere Bezeichnung: C19ORF47 (C19orf47 Produkte)

Synonyme: MGC79696 antikoerper, chromosome 19 open reading frame 47 antikoerper, chromosome 19 open reading frame 47 L homeolog antikoerper, RIKEN cDNA 2310022A10 gene antikoerper, similar to CG16812-PA antikoerper, chromosome 18 open reading frame, human C19orf47 antikoerper, C19orf47 antikoerper, c19orf47.L antikoerper, c19orf47 antikoerper, 2310022A10Rik antikoerper, RGD1307554 antikoerper, C18H19orf47 antikoerper

Hintergrund: The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 38 kDa (MW of target protein)