DPH2 Antikörper
-
- Target Alle DPH2 Antikörper anzeigen
- DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DPH2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVA
- Top Product
- Discover our top product DPH2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DPH2 Blocking Peptide, catalog no. 33R-9317, is also available for use as a blocking control in assays to test for specificity of this DPH2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPH2 (Diphthamide Biosynthesis Protein 2 (DPH2))
- Andere Bezeichnung
- DPH2 (DPH2 Produkte)
- Synonyme
- DPH2L2 antikoerper, 9130020C19Rik antikoerper, AI467389 antikoerper, Dph2l2 antikoerper, id:ibd5058 antikoerper, zgc:162269 antikoerper, DPH2 homolog antikoerper, DPH2 homolog (S. cerevisiae) antikoerper, hypothetical protein antikoerper, DPH2 antikoerper, Dph2 antikoerper, dph2 antikoerper, CAALFM_C400690CA antikoerper
- Hintergrund
- DPH2 gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 52 kDa (MW of target protein)
-