ODF3L1 Antikörper (N-Term)

Produktnummer ABIN631891

Produktdetails anti-ODF3L1 Antikörper

Target: ODF3L1 (Outer Dense Fiber of Sperm Tails 3-Like 1 (ODF3L1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ODF3L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ODF3 L1 antibody was raised against the N terminal of ODF3 1

Aufreinigung: Affinity purified

Immunogen: ODF3 L1 antibody was raised using the N terminal of ODF3 1 corresponding to a region with amino acids KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ODF3L1 Blocking Peptide, catalog no. 33R-4527, is also available for use as a blocking control in assays to test for specificity of this ODF3L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ODF3L1

Target: ODF3L1 (Outer Dense Fiber of Sperm Tails 3-Like 1 (ODF3L1))

Andere Bezeichnung: ODF3L1 (ODF3L1 Produkte)

Synonyme: BC049697 antikoerper, Gm1116 antikoerper, outer dense fiber of sperm tails 3 like 1 antikoerper, outer dense fiber of sperm tails 3-like 1 antikoerper, ODF3L1 antikoerper, Odf3l1 antikoerper

Hintergrund: The function of ODF3L1 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 31 kDa (MW of target protein)