PAD4 Antikörper (Middle Region)
-
- Target Alle PAD4 (PADI4) Antikörper anzeigen
- PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAD4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PADI4 antibody was raised against the middle region of PADI4
- Aufreinigung
- Affinity purified
- Immunogen
- PADI4 antibody was raised using the middle region of PADI4 corresponding to a region with amino acids TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL
- Top Product
- Discover our top product PADI4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PADI4 Blocking Peptide, catalog no. 33R-9085, is also available for use as a blocking control in assays to test for specificity of this PADI4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PADI4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))
- Andere Bezeichnung
- PADI4 (PADI4 Produkte)
- Synonyme
- PAD antikoerper, PAD4 antikoerper, PADI5 antikoerper, PDI4 antikoerper, PDI5 antikoerper, Pad4 antikoerper, Pdi4 antikoerper, peptidyl arginine deiminase 4 antikoerper, peptidyl arginine deiminase, type IV antikoerper, PADI4 antikoerper, Padi4 antikoerper
- Hintergrund
- PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.
- Molekulargewicht
- 74 kDa (MW of target protein)
-