ERCC5 Antikörper (N-Term)

Produktnummer ABIN631899

Produktdetails anti-ERCC5 Antikörper

Target: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERCC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ERCC5 antibody was raised against the N terminal of ERCC5

Aufreinigung: Affinity purified

Immunogen: ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERCC5 Blocking Peptide, catalog no. 33R-6828, is also available for use as a blocking control in assays to test for specificity of this ERCC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERCC5

Target: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Andere Bezeichnung: ERCC5 (ERCC5 Produkte)

Synonyme: COFS3 antikoerper, ERCM2 antikoerper, UVDR antikoerper, XPG antikoerper, XPGC antikoerper, cofs3 antikoerper, ercm2 antikoerper, uvdr antikoerper, xpg antikoerper, xpgc antikoerper, Xpg antikoerper, ERCC excision repair 5, endonuclease antikoerper, excision repair cross-complementation group 5 L homeolog antikoerper, excision repair cross-complementing rodent repair deficiency, complementation group 5 antikoerper, ERCC5 antikoerper, ercc5.L antikoerper, Ercc5 antikoerper

Hintergrund: Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage.

Molekulargewicht: 133 kDa (MW of target protein)

Pathways: DNA Reparatur