ERCC5 Antikörper (N-Term)

Produktnummer ABIN631899

Produktdetails anti-ERCC5 Antikörper

Target: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERCC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ERCC5 antibody was raised against the N terminal of ERCC5

Aufreinigung: Affinity purified

Immunogen: ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERCC5 Blocking Peptide, catalog no. 33R-6828, is also available for use as a blocking control in assays to test for specificity of this ERCC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERCC5

Target: ERCC5 (DNA Repair Protein Complementing XP-G Cells (ERCC5))

Andere Bezeichnung: ERCC5 (ERCC5 Produkte)

Hintergrund: Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage.

Molekulargewicht: 133 kDa (MW of target protein)

Pathways: DNA Reparatur