EARS2 Antikörper
-
- Target Alle EARS2 Antikörper anzeigen
- EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EARS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL
- Top Product
- Discover our top product EARS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EARS2 Blocking Peptide, catalog no. 33R-8975, is also available for use as a blocking control in assays to test for specificity of this EARS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EARS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))
- Andere Bezeichnung
- EARS2 (EARS2 Produkte)
- Synonyme
- mse1 antikoerper, 3230401I01Rik antikoerper, AL024049 antikoerper, mKIAA1970 antikoerper, COXPD12 antikoerper, MSE1 antikoerper, RGD1307904 antikoerper, ears2 antikoerper, glutamyl-tRNA synthetase 2, mitochondrial antikoerper, zgc:153247 antikoerper, EARS2 antikoerper, ears2 antikoerper, Ears2 antikoerper, zgc:153247 antikoerper
- Hintergrund
- EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.
- Molekulargewicht
- 59 kDa (MW of target protein)
-