FANCA Antikörper (N-Term)
-
- Target Alle FANCA Antikörper anzeigen
- FANCA (Fanconi Anemia Group A Protein (FANCA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FANCA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FANCA antibody was raised against the N terminal of FANCA
- Aufreinigung
- Affinity purified
- Immunogen
- FANCA antibody was raised using the N terminal of FANCA corresponding to a region with amino acids KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS
- Top Product
- Discover our top product FANCA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FANCA Blocking Peptide, catalog no. 33R-4540, is also available for use as a blocking control in assays to test for specificity of this FANCA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FANCA (Fanconi Anemia Group A Protein (FANCA))
- Andere Bezeichnung
- FANCA (FANCA Produkte)
- Synonyme
- FA antikoerper, FA-H antikoerper, FA1 antikoerper, FAA antikoerper, FACA antikoerper, FAH antikoerper, FANCH antikoerper, AW208693 antikoerper, Fanconi anemia complementation group A antikoerper, Fanconi anemia, complementation group A antikoerper, FANCA antikoerper, Fanca antikoerper
- Hintergrund
- The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.
- Molekulargewicht
- 33 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-