VPS37C Antikörper

Produktnummer ABIN631911

Produktdetails anti-VPS37C Antikörper

Target: VPS37C (Vacuolar Protein Sorting 37C (VPS37C))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VPS37C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: VPS37 C antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VPS37C Blocking Peptide, catalog no. 33R-5323, is also available for use as a blocking control in assays to test for specificity of this VPS37C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VPS37C

Target: VPS37C (Vacuolar Protein Sorting 37C (VPS37C))

Andere Bezeichnung: VPS37C (VPS37C Produkte)

Synonyme: RGD1309258 antikoerper, 5730409F24Rik antikoerper, AU042646 antikoerper, VPS37C, ESCRT-I subunit antikoerper, vacuolar protein sorting 37C antikoerper, VPS37C antikoerper, Vps37c antikoerper

Hintergrund: VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies.

Molekulargewicht: 39 kDa (MW of target protein)